(data stored in ACNUC1104 zone)

EMBL: FN667742.PE523

FN667742.PE523       Location/Qualifiers
FT   CDS             469325..469594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0103"
FT                   /locus_tag="XNC1_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88616"
FT                   /db_xref="GOA:D3VIR6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88616.1"
FT                   /translation="MRTTQQMSITLPKEMAELVKSKVRDGEYATESEVIRDGLRALLAR
FT                   DRAVENWLHNQVASAYDALITDPSRAVSIEQIRARLAERHGNSK"
     MRTTQQMSIT LPKEMAELVK SKVRDGEYAT ESEVIRDGLR ALLARDRAVE NWLHNQVASA        60
     YDALITDPSR AVSIEQIRAR LAERHGNSK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page