(data stored in ACNUC1104 zone)

EMBL: FN667742.PE524

FN667742.PE524       Location/Qualifiers
FT   CDS             469591..469908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0103"
FT                   /locus_tag="XNC1_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88617"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88617.1"
FT                   /translation="MSYTVIFSPEAETQIIELYDYIAAEASSNIAIRYTESIVNYCENL
FT                   STFPHRGIMRDDIRPGLRITNYKKRVVIAFIVNSERVSILGVFYGGQDFKTRLQSDDDN
FT                   H"
     MSYTVIFSPE AETQIIELYD YIAAEASSNI AIRYTESIVN YCENLSTFPH RGIMRDDIRP        60
     GLRITNYKKR VVIAFIVNSE RVSILGVFYG GQDFKTRLQS DDDNH                       105
//

If you have problems or comments...

PBIL Back to PBIL home page