(data stored in ACNUC1104 zone)

EMBL: FN667742.PE529

FN667742.PE529       Location/Qualifiers
FT   CDS             complement(472940..473461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0104"
FT                   /locus_tag="XNC1_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88622"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88622.1"
FT                   /translation="MTAGAIQSNHVRQTAAIAAKYGLKCVALLENPIRNQDSNFLNNGN
FT                   KLLTELFNAQCVMCNELTDPNVQMKALINQFKLEDAYIIPVGGSDVLLWDNYFAPMYGM
FT                   PNKKGLDAITLLAQKEGILLDPVYTGKAMAGLIDNVLNNTIDSQKPLLFVHTGGAPALF
FT                   AYSGIDAIID"
     MTAGAIQSNH VRQTAAIAAK YGLKCVALLE NPIRNQDSNF LNNGNKLLTE LFNAQCVMCN        60
     ELTDPNVQMK ALINQFKLED AYIIPVGGSD VLLWDNYFAP MYGMPNKKGL DAITLLAQKE       120
     GILLDPVYTG KAMAGLIDNV LNNTIDSQKP LLFVHTGGAP ALFAYSGIDA IID              173
//

If you have problems or comments...

PBIL Back to PBIL home page