(data stored in ACNUC1104 zone)

EMBL: FN667742.PE530

FN667742.PE530       Location/Qualifiers
FT   CDS             complement(473480..473611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0104"
FT                   /locus_tag="XNC1_0549"
FT                   /product="D-cysteine desulfhydrase, PLP-dependent enzyme
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88623"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88623.1"
FT                   /translation="MDKLENLSHYLGRDVYIKRDDLTPLTMGGNKLRKLEYLIADAL"
     MDKLENLSHY LGRDVYIKRD DLTPLTMGGN KLRKLEYLIA DAL                          43
//

If you have problems or comments...

PBIL Back to PBIL home page