(data stored in ACNUC1104 zone)

EMBL: FN667742.PE536

FN667742.PE536       Location/Qualifiers
FT   CDS             477105..477227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88629"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88629.1"
FT                   /translation="MKRAKDILSYFSSLFDQKSKMEEHIKKQEIIKKEKSETIS"
     MKRAKDILSY FSSLFDQKSK MEEHIKKQEI IKKEKSETIS                              40
//

If you have problems or comments...

PBIL Back to PBIL home page