(data stored in ACNUC1104 zone)

EMBL: FN667742.PE541

FN667742.PE541       Location/Qualifiers
FT   CDS             478637..478951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0105"
FT                   /locus_tag="XNC1_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88634"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88634.1"
FT                   /translation="MWAIGGATIRGEFTDVFDVKDLGDKYRLSGTIDYYLYDKFADPLD
FT                   MKNLIGEEWDGLGVPFDISDEWIETVSFDIDKGIYDNKIKPMVEQKQKEMIEQMKKMQQ
FT                   "
     MWAIGGATIR GEFTDVFDVK DLGDKYRLSG TIDYYLYDKF ADPLDMKNLI GEEWDGLGVP        60
     FDISDEWIET VSFDIDKGIY DNKIKPMVEQ KQKEMIEQMK KMQQ                        104
//

If you have problems or comments...

PBIL Back to PBIL home page