(data stored in ACNUC1104 zone)

EMBL: FN667742.PE550

FN667742.PE550       Location/Qualifiers
FT   CDS             complement(489240..489539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0569"
FT                   /product="Cro-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88643"
FT                   /db_xref="GOA:D3VIU3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88643.1"
FT                   /translation="MATLKELMAKRSPESQAKIEEKAAEMLLETQLYQIREALALSQTQ
FT                   VAKNLGIAQSSVAAIEQRGNELKISTLKKYIEAMGGEMTLGVKLPDGKLMNFSI"
     MATLKELMAK RSPESQAKIE EKAAEMLLET QLYQIREALA LSQTQVAKNL GIAQSSVAAI        60
     EQRGNELKIS TLKKYIEAMG GEMTLGVKLP DGKLMNFSI                               99
//

If you have problems or comments...

PBIL Back to PBIL home page