(data stored in ACNUC1104 zone)

EMBL: FN667742.PE558

FN667742.PE558       Location/Qualifiers
FT   CDS             494037..494378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88651"
FT                   /db_xref="GOA:D3VIV1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88651.1"
FT                   /translation="MDKKSSIFNGDWYIPKDDGYIKIHVAKNKNGLFSDLICEKLEVND
FT                   LLWIYGPYGDFTAQNRSEMRDIVFVATGTGFAPIKSLVESGVFNENKVSLFLGREKKSR
FT                   SLFLRKRLI"
     MDKKSSIFNG DWYIPKDDGY IKIHVAKNKN GLFSDLICEK LEVNDLLWIY GPYGDFTAQN        60
     RSEMRDIVFV ATGTGFAPIK SLVESGVFNE NKVSLFLGRE KKSRSLFLRK RLI              113
//

If you have problems or comments...

PBIL Back to PBIL home page