(data stored in ACNUC1104 zone)

EMBL: FN667742.PE559

FN667742.PE559       Location/Qualifiers
FT   CDS             complement(494392..495963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0109"
FT                   /locus_tag="XNC1_0578"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88652"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88652.1"
FT                   /translation="MEPPFPDDIAQLKGLLREQMAANKILTENNRLLSQRVASYASEIT
FT                   RLKARVVKLQRMQFGQSSEKIRQKAERQIREVQAHISHLQEEMVDILGKQPDPALPPAL
FT                   RQSSSRKPLPATLPREIQLLLPAEKNCPECGGERHALGCDISEQLEIISSAFKVIETQR
FT                   PKLACGRCDGIVQSPMPSKPIERSYAGPGLLARIVTAKFAEHMPLYRQSEIYNRQGVAL
FT                   SRATLGRWSGAVSELLEPLYDVLRQYVLMPGKVHGDDIPVPVQAPGNGKTRTGRLWVYV
FT                   RDDRNAGSVMPPAVWFAYSADRKGVHPQQHLAGYSGVLQADAYGGYRALYETGNITEAA
FT                   CMAHARRKIHDVHVRSPTAITTEALKRIGELYAIEAEIRGSPAEERLALRKARSAPLMQ
FT                   LLFDGIQQQRATLSRHSEIAKAFAYMLKLWDSLNEYCRNGWMEIDNNIAENALRCVAVG
FT                   RKNGLFAGSDSGGERAAILYSLIGSCRLNGVEPEAWLRYTISHIADWPSNKVHELLPWK
FT                   LNLTNI"
     MEPPFPDDIA QLKGLLREQM AANKILTENN RLLSQRVASY ASEITRLKAR VVKLQRMQFG        60
     QSSEKIRQKA ERQIREVQAH ISHLQEEMVD ILGKQPDPAL PPALRQSSSR KPLPATLPRE       120
     IQLLLPAEKN CPECGGERHA LGCDISEQLE IISSAFKVIE TQRPKLACGR CDGIVQSPMP       180
     SKPIERSYAG PGLLARIVTA KFAEHMPLYR QSEIYNRQGV ALSRATLGRW SGAVSELLEP       240
     LYDVLRQYVL MPGKVHGDDI PVPVQAPGNG KTRTGRLWVY VRDDRNAGSV MPPAVWFAYS       300
     ADRKGVHPQQ HLAGYSGVLQ ADAYGGYRAL YETGNITEAA CMAHARRKIH DVHVRSPTAI       360
     TTEALKRIGE LYAIEAEIRG SPAEERLALR KARSAPLMQL LFDGIQQQRA TLSRHSEIAK       420
     AFAYMLKLWD SLNEYCRNGW MEIDNNIAEN ALRCVAVGRK NGLFAGSDSG GERAAILYSL       480
     IGSCRLNGVE PEAWLRYTIS HIADWPSNKV HELLPWKLNL TNI                         523
//

If you have problems or comments...

PBIL Back to PBIL home page