(data stored in ACNUC1104 zone)

EMBL: FN667742.PE59

FN667742.PE59        Location/Qualifiers
FT   CDS             complement(66230..67207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0064"
FT                   /product="putative transport protein, possibly in
FT                   biosynthesis of type IV pilin (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88152"
FT                   /db_xref="GOA:D3VG62"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88152.1"
FT                   /translation="MRNPFLPPQPPMGDETTFSSTEQDEQEQEIEYQTIALKYADAEQI
FT                   SERLQKNLPALLTKWGKVEHDPFTNSLILEDKFDAITRIKNWLKEVDTPQQQVQIIAHI
FT                   VTSSREALHELGIHWGVTADPVNRSLGLNRLNLHQPAGSQRHRLVLNTARIHANLLEME
FT                   LSALEQENQLDIIASPRLTASHQHPASIKQGSEIPYVVQDKDKTTIQFKEAVLGMEVTP
FT                   HILREGKIRLALKISQNAPGFPVSQGGNENLAIDKQEIMTQVTVRNGETLILGGIFQQK
FT                   KVASQQKVPYLSDIPLLGTLFNQNGEQHSRRELVIFITPQLTDI"
     MRNPFLPPQP PMGDETTFSS TEQDEQEQEI EYQTIALKYA DAEQISERLQ KNLPALLTKW        60
     GKVEHDPFTN SLILEDKFDA ITRIKNWLKE VDTPQQQVQI IAHIVTSSRE ALHELGIHWG       120
     VTADPVNRSL GLNRLNLHQP AGSQRHRLVL NTARIHANLL EMELSALEQE NQLDIIASPR       180
     LTASHQHPAS IKQGSEIPYV VQDKDKTTIQ FKEAVLGMEV TPHILREGKI RLALKISQNA       240
     PGFPVSQGGN ENLAIDKQEI MTQVTVRNGE TLILGGIFQQ KKVASQQKVP YLSDIPLLGT       300
     LFNQNGEQHS RRELVIFITP QLTDI                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page