(data stored in ACNUC1104 zone)

EMBL: FN667742.PE591

FN667742.PE591       Location/Qualifiers
FT   CDS             520370..521152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0610"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88684"
FT                   /db_xref="GOA:D3VJC8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88684.1"
FT                   /translation="MRYILLFLVLLRHSFLLEFEFRFNAIVNLINSSLSCLLALLVLTG
FT                   FFGQVSQVGGWTYYQMVALLGVTLIIESFIDSWLFPSVHSLSEYIRRGDLDLIIIRPVD
FT                   TQFFISFHRFNIWDGANFIVGYVVVLLAMYQQDALTIWNFLQFNIALLLGACVFYSLFM
FT                   CSNLIAFWFTKVSDVWVICYSLMDIGRFPVSAYPGALRFLLSFLLPVFFVSNVPAQAAL
FT                   GILSMKTLLLAFLYAMGAIILTRLFWLKAISKYSSASS"
     MRYILLFLVL LRHSFLLEFE FRFNAIVNLI NSSLSCLLAL LVLTGFFGQV SQVGGWTYYQ        60
     MVALLGVTLI IESFIDSWLF PSVHSLSEYI RRGDLDLIII RPVDTQFFIS FHRFNIWDGA       120
     NFIVGYVVVL LAMYQQDALT IWNFLQFNIA LLLGACVFYS LFMCSNLIAF WFTKVSDVWV       180
     ICYSLMDIGR FPVSAYPGAL RFLLSFLLPV FFVSNVPAQA ALGILSMKTL LLAFLYAMGA       240
     IILTRLFWLK AISKYSSASS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page