(data stored in ACNUC1104 zone)

EMBL: FN667742.PE601

FN667742.PE601       Location/Qualifiers
FT   CDS             531296..531886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0115"
FT                   /locus_tag="XNC1_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88694"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88694.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMASLCERMYPNYQVFCRQSGFTDP
FT                   AQYRRILDIVWEILVVKDAKVNFDNQLEKLEAIIPSSESYDIYGVYPAIDACIALGEVI
FT                   HSRLSGSTLKHAIAVSEISIRTVAMLEMTQAGREMTEDELKVLPAIEEEWDIQWEIYRL
FT                   LANCEERDIELIKGLKADLREMGVSNIGINLEQ"
     MLRNPIHLRL EKLESWQHLT FMASLCERMY PNYQVFCRQS GFTDPAQYRR ILDIVWEILV        60
     VKDAKVNFDN QLEKLEAIIP SSESYDIYGV YPAIDACIAL GEVIHSRLSG STLKHAIAVS       120
     EISIRTVAML EMTQAGREMT EDELKVLPAI EEEWDIQWEI YRLLANCEER DIELIKGLKA       180
     DLREMGVSNI GINLEQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page