(data stored in ACNUC1104 zone)

EMBL: FN667742.PE603

FN667742.PE603       Location/Qualifiers
FT   CDS             532362..533063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0116"
FT                   /locus_tag="XNC1_0622"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88696"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88696.1"
FT                   /translation="MRGGYSKPLLLILQGLLALGFISLLSACSIQPKSSPFSASGFVAD
FT                   NGIIRLWRLNDQNSKPQVIMSVYSPYHNKNTTVTFYEYRHGNLWQIRRNVLGHSLNDKM
FT                   PIAETLRIDQNNVVIFKLRQLKDRNELLSDNDVKSLQLDAKQILETSDALIAKNIMLLQ
FT                   GHWQNSRVTTCAGKQLFIEFNPDAQRWLKERQSNSSGPLTIAWLDSSEGKQLLLVANDD
FT                   FCRWEPTKDKL"
     MRGGYSKPLL LILQGLLALG FISLLSACSI QPKSSPFSAS GFVADNGIIR LWRLNDQNSK        60
     PQVIMSVYSP YHNKNTTVTF YEYRHGNLWQ IRRNVLGHSL NDKMPIAETL RIDQNNVVIF       120
     KLRQLKDRNE LLSDNDVKSL QLDAKQILET SDALIAKNIM LLQGHWQNSR VTTCAGKQLF       180
     IEFNPDAQRW LKERQSNSSG PLTIAWLDSS EGKQLLLVAN DDFCRWEPTK DKL              233
//

If you have problems or comments...

PBIL Back to PBIL home page