(data stored in ACNUC1104 zone)

EMBL: FN667742.PE608

FN667742.PE608       Location/Qualifiers
FT   CDS             complement(541862..542533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88701"
FT                   /db_xref="GOA:D3VJE5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88701.1"
FT                   /translation="MTMKKDHTPQILSKKIAETIRNKLVTGELLPGQQLSEAALSKQLE
FT                   ISRNTLREVFRLLTQEGLLKHEPNRGVFVATPDIGSILDIYRVRQLIECQALIQAYSMH
FT                   PSVAKMTEAIEIAQQCRDKKDWVGAGTANMCFHAAIVELTDSERLIAFYRNISAELRLA
FT                   FGILNNPELLYAPYIDKNAHILELINSGQNELAAKKMKSYLELSERTILAAYARKNNQE
FT                   L"
     MTMKKDHTPQ ILSKKIAETI RNKLVTGELL PGQQLSEAAL SKQLEISRNT LREVFRLLTQ        60
     EGLLKHEPNR GVFVATPDIG SILDIYRVRQ LIECQALIQA YSMHPSVAKM TEAIEIAQQC       120
     RDKKDWVGAG TANMCFHAAI VELTDSERLI AFYRNISAEL RLAFGILNNP ELLYAPYIDK       180
     NAHILELINS GQNELAAKKM KSYLELSERT ILAAYARKNN QEL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page