(data stored in ACNUC1104 zone)

EMBL: FN667742.PE610

FN667742.PE610       Location/Qualifiers
FT   CDS             543669..545267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /locus_tag="XNC1_0632"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88703"
FT                   /db_xref="GOA:D3VJE7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88703.1"
FT                   /translation="MRFLPINFNTIMVDLKGLSATLALLDSLNMAPIPGIEEIIPAART
FT                   LMIRFRPIKISAQQLAEEICHRDLQERSYAAGKKIEIPVHYNGEDLAIVAEILGMTIQE
FT                   VIRQHTENEHTVAFTGFAPGFAYMVSDTSSWDIPRKKIPRTYIPAGAVALAGEFSSVYP
FT                   QASPGGWQIIGITTERMWDLSRLSPALLQPGYRVNFRNAGRLRTTVGLPEVPSRNTASC
FT                   PGTSCHLEILSVGLQTLFQDLGRIGQSGLGISESGALDKSALRGANRIVGNVSDQACLE
FT                   IAQGGFKAIAHGQIVIAITGAPCPIEIKTPEGETLYVNTYQPIDLNDGDEISLGTPAAG
FT                   MRSYLAVRGGFAVPAILSSHSFDTLSNIGPSPLNVRDKLAVREISHCAAVSFSETPAFV
FT                   MPNKEDVVILDIILGPRTDWFTQEALNLLSQQIWQVTPQSNRIGLRLNGKHSLSRTKQQ
FT                   ELPSEGTCTGAIQIPASGQPVLFLADHPLTGGYPVIASVADYHLDLAGQVPINARIRFN
FT                   PISQFQEIQGSKDFS"
     MRFLPINFNT IMVDLKGLSA TLALLDSLNM APIPGIEEII PAARTLMIRF RPIKISAQQL        60
     AEEICHRDLQ ERSYAAGKKI EIPVHYNGED LAIVAEILGM TIQEVIRQHT ENEHTVAFTG       120
     FAPGFAYMVS DTSSWDIPRK KIPRTYIPAG AVALAGEFSS VYPQASPGGW QIIGITTERM       180
     WDLSRLSPAL LQPGYRVNFR NAGRLRTTVG LPEVPSRNTA SCPGTSCHLE ILSVGLQTLF       240
     QDLGRIGQSG LGISESGALD KSALRGANRI VGNVSDQACL EIAQGGFKAI AHGQIVIAIT       300
     GAPCPIEIKT PEGETLYVNT YQPIDLNDGD EISLGTPAAG MRSYLAVRGG FAVPAILSSH       360
     SFDTLSNIGP SPLNVRDKLA VREISHCAAV SFSETPAFVM PNKEDVVILD IILGPRTDWF       420
     TQEALNLLSQ QIWQVTPQSN RIGLRLNGKH SLSRTKQQEL PSEGTCTGAI QIPASGQPVL       480
     FLADHPLTGG YPVIASVADY HLDLAGQVPI NARIRFNPIS QFQEIQGSKD FS               532
//

If you have problems or comments...

PBIL Back to PBIL home page