(data stored in ACNUC1104 zone)

EMBL: FN667742.PE636

FN667742.PE636       Location/Qualifiers
FT   CDS             572329..572529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88729.1"
FT                   /translation="MNNVPHHGYGHGNVHEYELSCGNDRGLCYEGHVNAHLYSQQYCEY
FT                   GDALFSEKIKGGALIAYVFWL"
     MNNVPHHGYG HGNVHEYELS CGNDRGLCYE GHVNAHLYSQ QYCEYGDALF SEKIKGGALI        60
     AYVFWL                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page