(data stored in ACNUC1104 zone)

EMBL: FN667742.PE637

FN667742.PE637       Location/Qualifiers
FT   CDS             complement(572732..573358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0659"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88730"
FT                   /db_xref="GOA:D3VJH4"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88730.1"
FT                   /translation="MSWPFLAVFFSGWLYIDAAYRGTNWQQWVFRPVTMLLLLFWACQA
FT                   PNLETSGYLIITGLLTALLSDALRMLPSKYLLFSFITLFLSYLLYAISFALPMSFSFFF
FT                   PLPLILLAIGIVVILIVWTRLDNMRWRVIDSSMMALLMVWVAGEQYFSLSNESRFSVIA
FT                   GASLLLVAHCINIIDRYRFSFKLSKALVAASSFIGHFLIIRSLFL"
     MSWPFLAVFF SGWLYIDAAY RGTNWQQWVF RPVTMLLLLF WACQAPNLET SGYLIITGLL        60
     TALLSDALRM LPSKYLLFSF ITLFLSYLLY AISFALPMSF SFFFPLPLIL LAIGIVVILI       120
     VWTRLDNMRW RVIDSSMMAL LMVWVAGEQY FSLSNESRFS VIAGASLLLV AHCINIIDRY       180
     RFSFKLSKAL VAASSFIGHF LIIRSLFL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page