(data stored in ACNUC1104 zone)

EMBL: FN667742.PE638

FN667742.PE638       Location/Qualifiers
FT   CDS             complement(573585..573854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0122"
FT                   /locus_tag="XNC1_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88731"
FT                   /db_xref="GOA:D3VJH5"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88731.1"
FT                   /translation="MFIQLGRVIMVFVWGIMIFNLFHPFPKPLKYFMDIAMVFTVIMHA
FT                   FQLLLLKHSQPKDQKLSAILQTKIFFFGVFELLEWQKKQRREKK"
     MFIQLGRVIM VFVWGIMIFN LFHPFPKPLK YFMDIAMVFT VIMHAFQLLL LKHSQPKDQK        60
     LSAILQTKIF FFGVFELLEW QKKQRREKK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page