(data stored in ACNUC1104 zone)

EMBL: FN667742.PE64

FN667742.PE64        Location/Qualifiers
FT   CDS             complement(72194..72604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0069"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88157"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88157.1"
FT                   /translation="MALFMRKREPSIHTGRQFVTAQHLPVLERVLSLADYLRQMGKRSA
FT                   FIVADILDEQDWTPFERQSASTGRAPYSPHAMMGILLYGIMKGHCSLRELERLARFDLG
FT                   CIFVSQGITPDHASLGRFIIPLWMEASSLPKP"
     MALFMRKREP SIHTGRQFVT AQHLPVLERV LSLADYLRQM GKRSAFIVAD ILDEQDWTPF        60
     ERQSASTGRA PYSPHAMMGI LLYGIMKGHC SLRELERLAR FDLGCIFVSQ GITPDHASLG       120
     RFIIPLWMEA SSLPKP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page