(data stored in ACNUC1104 zone)

EMBL: FN667742.PE644

FN667742.PE644       Location/Qualifiers
FT   CDS             578940..579737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0666"
FT                   /product="conserved hypothetical protein; Putative
FT                   permease"
FT                   /note="Evidence 6 : Doubtful CDS; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88737"
FT                   /db_xref="GOA:D3VJI1"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88737.1"
FT                   /translation="MTTVSALGAIIALVVAIVLILRKVPPVYGMMIGALLGGLIGGADV
FT                   AQTVSLMITGAQGMTNAVLRILAAGVLAGVLIESGAANTIAETIVRKAGEKRALLALAI
FT                   ATMLLTAVGVFIDVAVITVAPIALAIAHRADLSKMAILLAMIGGGKAGNVMSPNPNTIA
FT                   ASEGFHVPLTSLMAAGIVPGLFGLVTAYYLSRRLITKGYKVRNEELTLTEQETLPSFMA
FT                   AISAPVIAILLLALRPIANISCRAGGATIETLKADVQSQSTPE"
     MTTVSALGAI IALVVAIVLI LRKVPPVYGM MIGALLGGLI GGADVAQTVS LMITGAQGMT        60
     NAVLRILAAG VLAGVLIESG AANTIAETIV RKAGEKRALL ALAIATMLLT AVGVFIDVAV       120
     ITVAPIALAI AHRADLSKMA ILLAMIGGGK AGNVMSPNPN TIAASEGFHV PLTSLMAAGI       180
     VPGLFGLVTA YYLSRRLITK GYKVRNEELT LTEQETLPSF MAAISAPVIA ILLLALRPIA       240
     NISCRAGGAT IETLKADVQS QSTPE                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page