(data stored in ACNUC1104 zone)

EMBL: FN667742.PE67

FN667742.PE67        Location/Qualifiers
FT   CDS             complement(73600..74403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0013"
FT                   /locus_tag="XNC1_0072"
FT                   /product="putative Protein tonB"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88160"
FT                   /db_xref="GOA:D3VG70"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88160.1"
FT                   /translation="MTHTAIFDNPTLISQKGLLISILIAILLHINLIWLFNRHTSYPDD
FT                   AAHHINNNASAMTLSITMVAASSWNHEPEPVSPPPPLLTAPESPTKPEIALDKAVHPEN
FT                   RVEKPQGSHKPKKRQKPQKEKPQEIAAKKPIQSTPVQKEINAETHGSDQVNSQSSMSRA
FT                   STSQPLVGQGKSEWDNYHARLRQEIEHHKEYPRKAKRMKQQGIVIINFTLLNDGTLTAA
FT                   KVVNSSGNSTLDNAALNAIHRARSVGVKPADIPSDVTLRLDFKLD"
     MTHTAIFDNP TLISQKGLLI SILIAILLHI NLIWLFNRHT SYPDDAAHHI NNNASAMTLS        60
     ITMVAASSWN HEPEPVSPPP PLLTAPESPT KPEIALDKAV HPENRVEKPQ GSHKPKKRQK       120
     PQKEKPQEIA AKKPIQSTPV QKEINAETHG SDQVNSQSSM SRASTSQPLV GQGKSEWDNY       180
     HARLRQEIEH HKEYPRKAKR MKQQGIVIIN FTLLNDGTLT AAKVVNSSGN STLDNAALNA       240
     IHRARSVGVK PADIPSDVTL RLDFKLD                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page