(data stored in ACNUC1104 zone)

EMBL: FN667742.PE74

FN667742.PE74        Location/Qualifiers
FT   CDS             82145..82399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0079"
FT                   /product="formate dehydrogenase-O, major subunit
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88167"
FT                   /db_xref="GOA:D3VG77"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88167.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTAAALPTAAIAQTRNYKLLRARETRN
FT                   TCTYCSVGCGLLMYSLGDGAKNRGISVSTISAKRGSTGQ"
     MQVSRRQFFK ICAGGMAGTT AAALPTAAIA QTRNYKLLRA RETRNTCTYC SVGCGLLMYS        60
     LGDGAKNRGI SVSTISAKRG STGQ                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page