(data stored in ACNUC1104 zone)

EMBL: FN667742.PE76

FN667742.PE76        Location/Qualifiers
FT   CDS             82739..83017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0014"
FT                   /locus_tag="XNC1_0081"
FT                   /product="CcdA protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15774890; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88169"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88169.1"
FT                   /translation="MTRVLTRVICGDYMTALHSRTKKTVSVTVSPELYEQAKQIGLNFS
FT                   AILTQALIAELKSAAAEQWKRDNREGFEELNRITREHGLLSDQYRTF"
     MTRVLTRVIC GDYMTALHSR TKKTVSVTVS PELYEQAKQI GLNFSAILTQ ALIAELKSAA        60
     AEQWKRDNRE GFEELNRITR EHGLLSDQYR TF                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page