(data stored in ACNUC1104 zone)

EMBL: FN667742.PE79

FN667742.PE79        Location/Qualifiers
FT   CDS             complement(83427..85505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0015"
FT                   /locus_tag="XNC1_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88172"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88172.1"
FT                   /translation="MKLTPEKLFTAINEYAHQPEKKRYLTPKQVQWFADPENVFLLIAI
FT                   VLTIPEEVMDKIGDSISNWVEAAIAELALTATKLPVGVKRQFEGAIEETLNHAKENFAL
FT                   NSECVLLLLSILKKNQFNIQTDITQLLEISEHDDNAGVVSFPTQPIRLSQLLDQYDIQS
FT                   GIEFIEFFENGVSVVPHEALPHLLSELSKYSWGIDALLLLTQYFEEPVALASGQVLDSC
FT                   PSSAWANLSYQQLINLCARFNRHPSVKHSMKRWKKLAMKHCHARATAKIHELYVSHVDG
FT                   NDCASIMMKATLNGEDDQLSMMLDFKSGIRETFLDIDPNKSLTELIAQLDDSVDFTPVS
FT                   PEWLQQILPWILSVQHSKNTPLDLYSLYWLSQLPAEWTEPEEFEFENWNQKLSYQADFQ
FT                   RKERNRLSSIYMKHFSPLLMTWLAPEECLLEAKKPRDLLKNYYYANRDLFTERLTYSAA
FT                   VERYKLPPSAQRFANDYLDLAHSLHDPALNRKKFSLFDALSEMSFEFFAMMLDPVNAEL
FT                   PLQGLVIKVSLLDASPAVWRRISVSNQLTLCELHDVIQDAMGWENAHLYCFDIGGIEIP
FT                   EEHYDQVRIGIFLNDIGSTLNYQYDFGDDWSHQVTVEKLLPKDIIQPEVTAGNGMCPAE
FT                   DSGGIWHWNHLLKLRKKKILTEEEAEQLEWAGLSPDEQPEPFDKQLANKRLKALFNY"
     MKLTPEKLFT AINEYAHQPE KKRYLTPKQV QWFADPENVF LLIAIVLTIP EEVMDKIGDS        60
     ISNWVEAAIA ELALTATKLP VGVKRQFEGA IEETLNHAKE NFALNSECVL LLLSILKKNQ       120
     FNIQTDITQL LEISEHDDNA GVVSFPTQPI RLSQLLDQYD IQSGIEFIEF FENGVSVVPH       180
     EALPHLLSEL SKYSWGIDAL LLLTQYFEEP VALASGQVLD SCPSSAWANL SYQQLINLCA       240
     RFNRHPSVKH SMKRWKKLAM KHCHARATAK IHELYVSHVD GNDCASIMMK ATLNGEDDQL       300
     SMMLDFKSGI RETFLDIDPN KSLTELIAQL DDSVDFTPVS PEWLQQILPW ILSVQHSKNT       360
     PLDLYSLYWL SQLPAEWTEP EEFEFENWNQ KLSYQADFQR KERNRLSSIY MKHFSPLLMT       420
     WLAPEECLLE AKKPRDLLKN YYYANRDLFT ERLTYSAAVE RYKLPPSAQR FANDYLDLAH       480
     SLHDPALNRK KFSLFDALSE MSFEFFAMML DPVNAELPLQ GLVIKVSLLD ASPAVWRRIS       540
     VSNQLTLCEL HDVIQDAMGW ENAHLYCFDI GGIEIPEEHY DQVRIGIFLN DIGSTLNYQY       600
     DFGDDWSHQV TVEKLLPKDI IQPEVTAGNG MCPAEDSGGI WHWNHLLKLR KKKILTEEEA       660
     EQLEWAGLSP DEQPEPFDKQ LANKRLKALF NY                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page