(data stored in ACNUC1104 zone)

EMBL: FN667742.PE81

FN667742.PE81        Location/Qualifiers
FT   CDS             85742..86050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0016"
FT                   /locus_tag="XNC1_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88174"
FT                   /db_xref="GOA:D3VG84"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88174.1"
FT                   /translation="MSILKNLYQHRAERLKTLATENHPFSSYLNFAAEIVQAQQKALYD
FT                   NPLSHPVTGVTRLAIRSFVCHSRRHRRRYCTTQRIFTFYSSITADSPASSLFSKSTA"
     MSILKNLYQH RAERLKTLAT ENHPFSSYLN FAAEIVQAQQ KALYDNPLSH PVTGVTRLAI        60
     RSFVCHSRRH RRRYCTTQRI FTFYSSITAD SPASSLFSKS TA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page