(data stored in ACNUC1104 zone)

EMBL: FN667742.PE86

FN667742.PE86        Location/Qualifiers
FT   CDS             90355..91812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0017"
FT                   /locus_tag="XNC1_0091"
FT                   /product="Cytosine/purines, uracil, thiamine, allantoin
FT                   permease family protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88179"
FT                   /db_xref="GOA:D3VG89"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88179.1"
FT                   /translation="MSTQQNRHRFWKVERTGIDLVPASERTGTPLDLFWVWSAANIGIL
FT                   GIVYGAIIVSFKLSFLQSVLAALIGLSSFALVGYVSFSGKRGRTTTLTLSRTIFGIKGN
FT                   TAPTVIFWFISMGWESINIVTGTLTLSALFQACGLAESTLLTVASMILFAGLSIGVTLL
FT                   GKEMVITLQRWVIQIFGIMTLVVVFYILMMTKWETVLSMPPGSWLTGFLPAVSVVAAGS
FT                   GIAWAASSADYSRFQNENSSNAKIFTAVTAGGMIPLVLLLFAGILLSVQLPDLPNSDNP
FT                   IAHIGSILPDWMLIPYLMTALAGIVIMAVMSLYSASLNLLTLGIKVKRIHAVTIDSVIV
FT                   LTVAVYTLFVTGDFMGPFIAFLIFFGVFLAAWEAVFLLDYIVIRRKQGYCPDTLFNDSG
FT                   PNGGIKWVPISCWLLGALAGFMVTKNDFMSGPWAVGIFANSSFGLFLSFFVSLICYGLY
FT                   LMLNRDKRLKHLYCLSLSWDRRQGILF"
     MSTQQNRHRF WKVERTGIDL VPASERTGTP LDLFWVWSAA NIGILGIVYG AIIVSFKLSF        60
     LQSVLAALIG LSSFALVGYV SFSGKRGRTT TLTLSRTIFG IKGNTAPTVI FWFISMGWES       120
     INIVTGTLTL SALFQACGLA ESTLLTVASM ILFAGLSIGV TLLGKEMVIT LQRWVIQIFG       180
     IMTLVVVFYI LMMTKWETVL SMPPGSWLTG FLPAVSVVAA GSGIAWAASS ADYSRFQNEN       240
     SSNAKIFTAV TAGGMIPLVL LLFAGILLSV QLPDLPNSDN PIAHIGSILP DWMLIPYLMT       300
     ALAGIVIMAV MSLYSASLNL LTLGIKVKRI HAVTIDSVIV LTVAVYTLFV TGDFMGPFIA       360
     FLIFFGVFLA AWEAVFLLDY IVIRRKQGYC PDTLFNDSGP NGGIKWVPIS CWLLGALAGF       420
     MVTKNDFMSG PWAVGIFANS SFGLFLSFFV SLICYGLYLM LNRDKRLKHL YCLSLSWDRR       480
     QGILF                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page