(data stored in ACNUC1104 zone)

EMBL: FN667742.PE88

FN667742.PE88        Location/Qualifiers
FT   CDS             92814..93137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88181"
FT                   /db_xref="GOA:D3VG91"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88181.1"
FT                   /translation="MRKITSFSMGEQLDGFVQRMIESGRYGSTSEVMRSALRLLEQQEN
FT                   QDEAIRNAVIDGLNSGKSSLTLRDIAEQRKRQRISKPLTVLPISPDTNPDIFNIHLHQI
FT                   ASV"
     MRKITSFSMG EQLDGFVQRM IESGRYGSTS EVMRSALRLL EQQENQDEAI RNAVIDGLNS        60
     GKSSLTLRDI AEQRKRQRIS KPLTVLPISP DTNPDIFNIH LHQIASV                     107
//

If you have problems or comments...

PBIL Back to PBIL home page