(data stored in ACNUC1104 zone)

EMBL: FN667742.PE89

FN667742.PE89        Location/Qualifiers
FT   CDS             complement(93176..93769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88182"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88182.1"
FT                   /translation="MLLKTRGALQASDAGKLLGTTGEAARQQFVKLAKEGLIEAKSETR
FT                   GVGRPVQLWHLTKKGHAQFPDTHAELTTQLITIIRNQLGETAMDVIIHSREKEALSNYK
FT                   KNMEGITHLQERVERLVAIRCREGYMANYSIEENGAFLFFENHCPICSAAKICQGFCRT
FT                   ELKIFREILQANVERTEYILSGDRRCAYRITPLV"
     MLLKTRGALQ ASDAGKLLGT TGEAARQQFV KLAKEGLIEA KSETRGVGRP VQLWHLTKKG        60
     HAQFPDTHAE LTTQLITIIR NQLGETAMDV IIHSREKEAL SNYKKNMEGI THLQERVERL       120
     VAIRCREGYM ANYSIEENGA FLFFENHCPI CSAAKICQGF CRTELKIFRE ILQANVERTE       180
     YILSGDRRCA YRITPLV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page