(data stored in ACNUC1104 zone)

EMBL: FN667742.PE90

FN667742.PE90        Location/Qualifiers
FT   CDS             93927..95336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0095"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88183"
FT                   /db_xref="GOA:D3VG93"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88183.1"
FT                   /translation="MIMTEEGRWRDLFSGKNASSAIVLSLGVGLMAVNTLIAITILPSI
FT                   VRDIGGLNLYAWNTTLFVIASIIGSILSARLLSTSGARNAYLVASLIFFVGSLICTLAP
FT                   SMGIMLIGRTVQGFGGGFLFALSYSMIHLVFEQALWSRAMALISGVWGIATLIGPAIGG
FT                   IFAEMNAWRYAFGTMVPVLLLYALFSYLILPKRVQSTTKTALPIIQLILLSVAVLAVSS
FT                   GSLSQDVRVNIIGIFIAVVLVFILIIYERRTSARLMPKNTFSLHSPHLILFATIFLLTV
FT                   GLSGDVFIPYFLQMLHGQSPLISGYMVAIAALGWSAGEMLSAGWQGAKMRFAVVSGPVF
FT                   MLAGMLFLFVILPYPSAGEWQIVLPIMLGLGLFGFGVGLGWPHLLTRLLQVSSEADKSI
FT                   AGSSITTIQLFSTAFGSALGGMIVNIFGFYEPGGKEGAAVSSYWLFLIFAIAPVLAFLT
FT                   AYKSAKIKVEK"
     MIMTEEGRWR DLFSGKNASS AIVLSLGVGL MAVNTLIAIT ILPSIVRDIG GLNLYAWNTT        60
     LFVIASIIGS ILSARLLSTS GARNAYLVAS LIFFVGSLIC TLAPSMGIML IGRTVQGFGG       120
     GFLFALSYSM IHLVFEQALW SRAMALISGV WGIATLIGPA IGGIFAEMNA WRYAFGTMVP       180
     VLLLYALFSY LILPKRVQST TKTALPIIQL ILLSVAVLAV SSGSLSQDVR VNIIGIFIAV       240
     VLVFILIIYE RRTSARLMPK NTFSLHSPHL ILFATIFLLT VGLSGDVFIP YFLQMLHGQS       300
     PLISGYMVAI AALGWSAGEM LSAGWQGAKM RFAVVSGPVF MLAGMLFLFV ILPYPSAGEW       360
     QIVLPIMLGL GLFGFGVGLG WPHLLTRLLQ VSSEADKSIA GSSITTIQLF STAFGSALGG       420
     MIVNIFGFYE PGGKEGAAVS SYWLFLIFAI APVLAFLTAY KSAKIKVEK                   469
//

If you have problems or comments...

PBIL Back to PBIL home page