(data stored in ACNUC1104 zone)

EMBL: FN667742.PE99

FN667742.PE99        Location/Qualifiers
FT   CDS             101199..101495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0019"
FT                   /locus_tag="XNC1_0104"
FT                   /product="putative transcriptional regulator with
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88192"
FT                   /db_xref="GOA:D3VGA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88192.1"
FT                   /translation="MDKKLFDDLIESMNQMVAIDKGELSVPAENIHRHRLPDVKKLRET
FT                   FGLKQSEFAEAVGVSASLIQSWEQHRRTPSGSSLKLLKMLERNPALINELSAL"
     MDKKLFDDLI ESMNQMVAID KGELSVPAEN IHRHRLPDVK KLRETFGLKQ SEFAEAVGVS        60
     ASLIQSWEQH RRTPSGSSLK LLKMLERNPA LINELSAL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page