(data stored in ACNUC1104 zone)

EMBL: FN667742.RFFE

FN667742.RFFE        Location/Qualifiers
FT   CDS             111780..112907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /gene="rffE"
FT                   /locus_tag="XNC1_0116"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88204"
FT                   /db_xref="GOA:D3VGB4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88204.1"
FT                   /translation="MKILLVFGTRPEAIKMASLIYELKKHSNFNVRVCVTGQHRDMLDQ
FT                   VLNLFNIIPDIDLNIMESSQDLTSITCNILTKLKHVIFEEKPDLVLVHGDTTTTFAASL
FT                   SAFYHKVKVGHIEAGLRTGNIDSPWPEEANRKLVSSLACLHFTPTATARNNLISENINS
FT                   DTIFVTGNTVIDSLLEMKSIIGKNINLQTRFDYEFSFINKYKKSILITGHRRENFGQGF
FT                   QNICHAIKLLAQKNQDVCFIYPVHLNPNVKNVVEKTLYGQNNIYLISPQTYDSFVYLMS
FT                   RAYIILTDSGGIQEEAPSLGKPVLVMRNSTERPEAISAGTVKLVGTSTDEIYSSVTKLL
FT                   NNANLYLEMSKSCNPYGDGKASKYIAKILLKNFIN"
     MKILLVFGTR PEAIKMASLI YELKKHSNFN VRVCVTGQHR DMLDQVLNLF NIIPDIDLNI        60
     MESSQDLTSI TCNILTKLKH VIFEEKPDLV LVHGDTTTTF AASLSAFYHK VKVGHIEAGL       120
     RTGNIDSPWP EEANRKLVSS LACLHFTPTA TARNNLISEN INSDTIFVTG NTVIDSLLEM       180
     KSIIGKNINL QTRFDYEFSF INKYKKSILI TGHRRENFGQ GFQNICHAIK LLAQKNQDVC       240
     FIYPVHLNPN VKNVVEKTLY GQNNIYLISP QTYDSFVYLM SRAYIILTDS GGIQEEAPSL       300
     GKPVLVMRNS TERPEAISAG TVKLVGTSTD EIYSSVTKLL NNANLYLEMS KSCNPYGDGK       360
     ASKYIAKILL KNFIN                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page