(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLC

FN667742.RPLC        Location/Qualifiers
FT   CDS             267111..267743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplC"
FT                   /locus_tag="XNC1_0317"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88399"
FT                   /db_xref="GOA:D3VHR0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88399.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIENNRVTQVKNDETDGY
FT                   RAIQVTTGSKKANRVNKSEAGHFAKAGVEAGRILREFRLSEGDAEFTVGQSISVEIFAD
FT                   VKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMA
FT                   GQLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATNSNLIVKPAVKA"
     MIGLVGKKVG MTRIFTEDGV SIPVTVIEIE NNRVTQVKND ETDGYRAIQV TTGSKKANRV        60
     NKSEAGHFAK AGVEAGRILR EFRLSEGDAE FTVGQSISVE IFADVKKVDV TGTSKGKGFA       120
     GTVKRWNFRT QDATHGNSLS HRVPGSIGQN QTPGKVFKGK KMAGQLGNER VTVQSLDVVR       180
     VDAERNLLLV KGAVPGATNS NLIVKPAVKA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page