(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLE

FN667742.RPLE        Location/Qualifiers
FT   CDS             272626..273165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplE"
FT                   /locus_tag="XNC1_0330"
FT                   /product="50S ribosomal subunit protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88412"
FT                   /db_xref="GOA:D3VHS3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88412.1"
FT                   /translation="MAKLHDYYKDEVVQKLMTQFGYHSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGKRMWEFFERLI
FT                   SIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFNFPFRK"
     MAKLHDYYKD EVVQKLMTQF GYHSVMQVPR VEKITLNMGV GEAIADKKLL DNAAADLTAI        60
     SGQKPLITKA RKSVAGFKIR QGYPIGCKVT LRGKRMWEFF ERLISIAVPR IRDFRGLSAK       120
     SFDGRGNYSM GVREQIIFPE IDYDKVDRVR GLDITITTTA KSDDEGRALL AAFNFPFRK        179
//

If you have problems or comments...

PBIL Back to PBIL home page