(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLF

FN667742.RPLF        Location/Qualifiers
FT   CDS             273924..274457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplF"
FT                   /locus_tag="XNC1_0333"
FT                   /product="50S ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88415"
FT                   /db_xref="GOA:D3VHS6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88415.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSREIHNAVEVTH
FT                   ADNQLTFAPREGFADAWAQAGTTRSLLNAMVIGVNEGFTKKLQLVGVGYRAAVKGNAVS
FT                   LSLGFSHPVEHQLPAGITAECPSQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
     MSRVAKAPVV IPAGVEVKLN GQVISIKGKN GELSREIHNA VEVTHADNQL TFAPREGFAD        60
     AWAQAGTTRS LLNAMVIGVN EGFTKKLQLV GVGYRAAVKG NAVSLSLGFS HPVEHQLPAG       120
     ITAECPSQTE IVLKGADKQV IGQVAADLRA YRRPEPYKGK GVRYADEVVR TKEAKKK          177
//

If you have problems or comments...

PBIL Back to PBIL home page