(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLP

FN667742.RPLP        Location/Qualifiers
FT   CDS             270918..271295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplP"
FT                   /locus_tag="XNC1_0325"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88407"
FT                   /db_xref="GOA:D3VHR8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88407.1"
FT                   /translation="MHKGRNRVLAAGAEVSFGTFGLKAVGRGRLTARQIEAARRAMTRA
FT                   IKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELARE
FT                   AFKLAAAKLPIKTTFVTKTVM"
     MHKGRNRVLA AGAEVSFGTF GLKAVGRGRL TARQIEAARR AMTRAIKRQG KIWIRVFPDK        60
     PITEKPLEVR MGKGKGNVEY WVALIQPGKV LYEMDGVPEE LAREAFKLAA AKLPIKTTFV       120
     TKTVM                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page