(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLQ

FN667742.RPLQ        Location/Qualifiers
FT   CDS             280069..280461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rplQ"
FT                   /locus_tag="XNC1_0344"
FT                   /product="50S ribosomal subunit protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88426"
FT                   /db_xref="GOA:D3VHT7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88426.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAAESQTEAASAE"
     MRHRKSGRQL NRNSSHRQAM FRNMAGSLVR HEIIKTTLPK AKELRRVVEP LITLAKTDSV        60
     ANRRLAFART RDNEIVAKLF NELGPRFASR AGGYTRILKC GFRAGDNAPM AYIELVDRAA       120
     ESQTEAASAE                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page