(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLV

FN667742.RPLV        Location/Qualifiers
FT   CDS             269816..270148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplV"
FT                   /locus_tag="XNC1_0322"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88404"
FT                   /db_xref="GOA:D3VHR5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88404.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPTMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
     METIAKHRHA RSSAQKVRLV ADLIRGKKVS QALETLTYTN KKAAGLVKKV LESAIANAEH        60
     NDGADIDDLK VTKIFVDEGP TMKRIMPRAK GRADRILKRT SHITVVVSDR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page