(data stored in ACNUC1104 zone)

EMBL: FN667742.RPLW

FN667742.RPLW        Location/Qualifiers
FT   CDS             268362..268664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rplW"
FT                   /locus_tag="XNC1_0319"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88401"
FT                   /db_xref="GOA:D3VHR2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88401.1"
FT                   /translation="MIREERLLKVLRAPHVSEKASTAMEKTNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEGVNTLLAKGKVKRHGQRVGRRSDWKKAYVTLKEGQNLDFVGGAE"
     MIREERLLKV LRAPHVSEKA STAMEKTNTI VLKVAKDATK AEIKAAVQKL FEVEVEGVNT        60
     LLAKGKVKRH GQRVGRRSDW KKAYVTLKEG QNLDFVGGAE                             100
//

If you have problems or comments...

PBIL Back to PBIL home page