(data stored in ACNUC1104 zone)

EMBL: FN667742.RPMC

FN667742.RPMC        Location/Qualifiers
FT   CDS             271295..271486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpmC"
FT                   /locus_tag="XNC1_0326"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88408"
FT                   /db_xref="GOA:D3VHR9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88408.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQSHLLKQ
FT                   VRRNIARVKTLLTEKAGA"
     MKAQELREKS VEELNTELLN LLREQFNLRM QAASGQLQQS HLLKQVRRNI ARVKTLLTEK        60
     AGA                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page