(data stored in ACNUC1104 zone)

EMBL: FN667742.RPME

FN667742.RPME        Location/Qualifiers
FT   CDS             198675..198890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="XNC1_0224"
FT                   /product="50S ribosomal subunit protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88312"
FT                   /db_xref="GOA:D3VH27"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88312.1"
FT                   /translation="MKQGIHPKYEEITASCSCGNVMKINSTVGHDLNLDVCGDCHPFYT
FT                   GKQRDVATGGRVDRFNKRFSVPGAKK"
     MKQGIHPKYE EITASCSCGN VMKINSTVGH DLNLDVCGDC HPFYTGKQRD VATGGRVDRF        60
     NKRFSVPGAK K                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page