(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSD

FN667742.RPSD        Location/Qualifiers
FT   CDS             278393..279013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsD"
FT                   /locus_tag="XNC1_0342"
FT                   /product="30S ribosomal subunit protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88424"
FT                   /db_xref="GOA:D3VHT5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88424.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKLEQAPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEATRLKGNTGENLLNLLESRLDNVVYR
FT                   MGFGATRAESRQMVSHKAITVNGRVVNIASYQVSPNDVVSVREKAKKQARIKAALELAE
FT                   QREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK"
     MARYLGPKLK LSRREGTDLF LKSGVRAIDT KCKLEQAPGQ HGARKPRLSD YGVQLREKQK        60
     VRRIYGVLER QFRNYYKEAT RLKGNTGENL LNLLESRLDN VVYRMGFGAT RAESRQMVSH       120
     KAITVNGRVV NIASYQVSPN DVVSVREKAK KQARIKAALE LAEQREKPTW LEVDAAKMEG       180
     VFKRIPERTD LSADINEHLI VELYSK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page