(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSE

FN667742.RPSE        Location/Qualifiers
FT   CDS             274835..275335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsE"
FT                   /locus_tag="XNC1_0335"
FT                   /product="30S ribosomal subunit protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88417"
FT                   /db_xref="GOA:D3VHS8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88417.1"
FT                   /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMKTVALNSGTLYHPVKGSHTGSRVFMQPAHEGTG
FT                   IIAGGAMRAVLEVSGVRNVLAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEE
FT                   ILG"
     MAHIEKQAGE LQEKLIAVNR VSKTVKGGRI FSFTALTVVG DGNGRVGFGY GKAREVPAAI        60
     QKAMEKARRN MKTVALNSGT LYHPVKGSHT GSRVFMQPAH EGTGIIAGGA MRAVLEVSGV       120
     RNVLAKTYGS TNPINVVRAT LDALDSMKSP EMVAAKRGKS VEEILG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page