(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSF

FN667742.RPSF        Location/Qualifiers
FT   CDS             399323..399721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0086"
FT                   /gene="rpsF"
FT                   /locus_tag="XNC1_0465"
FT                   /product="30S ribosomal subunit protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88539"
FT                   /db_xref="GOA:D3VII9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88539.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAQGQIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRSRDLVLEEGLVDDVDEAGDSEE"
     MRHYEIVFMV HPDQSEQVPG MIERYSATIT NAQGQIHRLE DWGRRQLAYP INKLHKAHYV        60
     LLNVEAPQEA IDELETNFRF NDAVIRSMVM RVKHAVTEAS PMVKAKDERR SRDLVLEEGL       120
     VDDVDEAGDS EE                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page