(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSM

FN667742.RPSM        Location/Qualifiers
FT   CDS             277596..277952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0065"
FT                   /gene="rpsM"
FT                   /locus_tag="XNC1_0340"
FT                   /product="30S ribosomal subunit protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88422"
FT                   /db_xref="GOA:D3VHT3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88422.1"
FT                   /translation="MARIAGINIPDQKHTVIALTSIYGIGKTRSQAICAAAGIAENVKI
FT                   RELSEEQIDKLRDEVAKYVVEGDLRREVTLSIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
     MARIAGINIP DQKHTVIALT SIYGIGKTRS QAICAAAGIA ENVKIRELSE EQIDKLRDEV        60
     AKYVVEGDLR REVTLSIKRL MDLGCYRGLR HRRGLPVRGQ RTKTNARTRK GPRKPIKK         118
//

If you have problems or comments...

PBIL Back to PBIL home page