(data stored in ACNUC1104 zone)

EMBL: FN667742.RPSQ

FN667742.RPSQ        Location/Qualifiers
FT   CDS             271486..271740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0064"
FT                   /gene="rpsQ"
FT                   /locus_tag="XNC1_0327"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88409"
FT                   /db_xref="GOA:D3VHS0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88409.1"
FT                   /translation="MTDKIRTLQGRVVSDKMEKSIVVAIERKVKHPLYGKFIKRTTKLH
FT                   VHDENNECGIGDVVEIRETRPLSKTKSWTLVRVVEKAVL"
     MTDKIRTLQG RVVSDKMEKS IVVAIERKVK HPLYGKFIKR TTKLHVHDEN NECGIGDVVE        60
     IRETRPLSKT KSWTLVRVVE KAVL                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page