(data stored in ACNUC1104 zone)

EMBL: FN667742.THIG

FN667742.THIG        Location/Qualifiers
FT   CDS             complement(498303..499070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0110"
FT                   /gene="thiG"
FT                   /locus_tag="XNC1_0582"
FT                   /product="thiamin biosynthesis enzyme subunit, with ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88656"
FT                   /db_xref="GOA:D3VIV6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88656.1"
FT                   /translation="MLKIADTTFHSRLFTGTGKFANAGLMIDAIRASGSQLVTMAMKRI
FT                   DLHGNDDGILVPLQQLGVKLLPNTSGAKTAEEAVFAARLAKEALGTHWVKLEIHPDVKY
FT                   LLPDPIETLKAAEQLLKEGFIVLPYCGADPVLCRRLEEAGCAAVMPLGAPIGSNKGLLT
FT                   RDFLQIIIEQANVPVVVDAGIGAPSHALTAIEMGADAVLVNTAIAVARHPVKMAQAFKT
FT                   AIEAGELSHQAGVASQKSHAETSSPLTDFLGAL"
     MLKIADTTFH SRLFTGTGKF ANAGLMIDAI RASGSQLVTM AMKRIDLHGN DDGILVPLQQ        60
     LGVKLLPNTS GAKTAEEAVF AARLAKEALG THWVKLEIHP DVKYLLPDPI ETLKAAEQLL       120
     KEGFIVLPYC GADPVLCRRL EEAGCAAVMP LGAPIGSNKG LLTRDFLQII IEQANVPVVV       180
     DAGIGAPSHA LTAIEMGADA VLVNTAIAVA RHPVKMAQAF KTAIEAGELS HQAGVASQKS       240
     HAETSSPLTD FLGAL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page