(data stored in ACNUC1104 zone)

EMBL: FN667742.THIH

FN667742.THIH        Location/Qualifiers
FT   CDS             complement(497182..498174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="XNC1_0581"
FT                   /product="thiamin biosynthesis enzyme subunit, with ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88655"
FT                   /db_xref="GOA:D3VIV5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88655.1"
FT                   /translation="MALLSPAALPYLEQLARRAQQLTRQRFGNTVGFFIPLYLSNLCAN
FT                   DCTYCGFSMSNHIKRKTLDEQEIEAECLALKKRGFEHILLVTGEHQNKVGMDYFRRYLP
FT                   LVHRHFSSVSMEVQPLAQEEYAELKTLGLDGVMVYQETYHQPSYQLHHLKGKKQDFHWR
FT                   LETPERLGRAGIDKIGLGALIGLSHNWRTDCYMVAEHLLFLQKQFWKSRYSISFPRLRP
FT                   CTGGIEPASIMGEAELVQLICAFRLLAPDVELSLSTRESPFFRDHVVPLAINSISAGSK
FT                   TQPGGYADEHHELEQFAPHDNRSVIQVAEALVKSGLQPVWKDWDSYLGR"
     MALLSPAALP YLEQLARRAQ QLTRQRFGNT VGFFIPLYLS NLCANDCTYC GFSMSNHIKR        60
     KTLDEQEIEA ECLALKKRGF EHILLVTGEH QNKVGMDYFR RYLPLVHRHF SSVSMEVQPL       120
     AQEEYAELKT LGLDGVMVYQ ETYHQPSYQL HHLKGKKQDF HWRLETPERL GRAGIDKIGL       180
     GALIGLSHNW RTDCYMVAEH LLFLQKQFWK SRYSISFPRL RPCTGGIEPA SIMGEAELVQ       240
     LICAFRLLAP DVELSLSTRE SPFFRDHVVP LAINSISAGS KTQPGGYADE HHELEQFAPH       300
     DNRSVIQVAE ALVKSGLQPV WKDWDSYLGR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page