(data stored in ACNUC1104 zone)

EMBL: FN667742.TRKA

FN667742.TRKA        Location/Qualifiers
FT   CDS             complement(281456..282832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="trkA"
FT                   /locus_tag="XNC1_0347"
FT                   /product="potassium transport protein, NAD(P)-binding (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88429"
FT                   /db_xref="GOA:D3VHU0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88429.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVDENNDITVVDTDTNRLRQLQDKFDL
FT                   RVVNGHGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNKVARIRSSEY
FT                   IRESEKLFQPDDIPIDYLISPEQLVIDYIYKLIQYPGALQVVNFAEGRVSIVAVKAYYG
FT                   GSLVGNALSSLREHMPHIDSKVAAIFRQDRPIRPQGSTVIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIEHNQERAIELAELLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIALTNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GGVIDIAISPQQATVSALLGHVRKADIVSVFSLRRGVAEAIEAIAHGDENTSKVVGRKI
FT                   GDIKLPPGTTIGAIVRDEEVIIANDYSIIEQGDHVIMFITDKKFVPEVEKLFQPSPFFL
FT                   "
     MKIIILGAGQ VGGTLAENLV DENNDITVVD TDTNRLRQLQ DKFDLRVVNG HGSHPRVLRE        60
     AGAEDADMLV AVTNSDETNM IACQIAYSLF NTPNKVARIR SSEYIRESEK LFQPDDIPID       120
     YLISPEQLVI DYIYKLIQYP GALQVVNFAE GRVSIVAVKA YYGGSLVGNA LSSLREHMPH       180
     IDSKVAAIFR QDRPIRPQGS TVIEAGDEVF FVAASQHIRA VMSELQRLEK PYKRIMIVGG       240
     GNVGAGLALR LEKDYSVKLI EHNQERAIEL AELLHDTIVF YGDASDQELL AEEHIEQVDV       300
     FIALTNDDEA NIMSAMLAKR MGAKKAMVLI QRSAYVDLVQ GGVIDIAISP QQATVSALLG       360
     HVRKADIVSV FSLRRGVAEA IEAIAHGDEN TSKVVGRKIG DIKLPPGTTI GAIVRDEEVI       420
     IANDYSIIEQ GDHVIMFITD KKFVPEVEKL FQPSPFFL                               458
//

If you have problems or comments...

PBIL Back to PBIL home page