(data stored in ACNUC1104 zone)

EMBL: FN667742.TUFB

FN667742.TUFB        Location/Qualifiers
FT   CDS             258325..259509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="XNC1_0297"
FT                   /product="putative protein chain elongation factor EF-Tu;
FT                   GTP-binding factor (duplicate of tufA)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88379"
FT                   /db_xref="GOA:D3VHP0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88379.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNAR
FT                   AFDQIDNAPEEKARGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVSLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA"
     MSKEKFERSK PHVNVGTIGH VDHGKTTLTA AITTVLAKTY GGNARAFDQI DNAPEEKARG        60
     ITISTSHVEY DTPTRHYAHV DCPGHADYVK NMITGAAQMD GAVLVVAATD GPMPQTREHI       120
     LLGRQVGVPY IIVFLNKCDM VDDEELLELV EMEVRELLSQ YDFPGDDTPI IRGSALKALE       180
     GEAEWEAKII ELAEALDSYI PEPERDIDKP FLLPIEDVFS ISGRGTVVTG RVERGIVKVG       240
     DEVEIVGIKE TTKTTCTGVE MFRKLLDEGR AGENVGVLLR GTKRDEIERG QVLAKPGSIK       300
     PHTQFESEVY ILSKDEGGRH TPFFKGYRPQ FYFRTTDVTG TIELPEGVEM VMPGDNINMI       360
     VSLIHPIAMD EGLRFAIREG GRTVGAGVVA KVIA                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page