(data stored in ACNUC1104 zone)

EMBL: FN667742.WZXE

FN667742.WZXE        Location/Qualifiers
FT   CDS             327158..328408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzxE"
FT                   /locus_tag="XNC1_0392"
FT                   /product="O-antigen translocase in LPS biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88469"
FT                   /db_xref="GOA:D3VHY0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88469.1"
FT                   /translation="MSLAKASVWTAGSTLIKIGVGLLVIKLLAVSFGPTGVGQAGNFRQ
FT                   LITVLGVLSGAGIFNGVTKYVAEYHQQPERLSALLGTSSSIILGFSTLLAVIFLLFSDA
FT                   ISVGLFGHNHYKIVVQALAFIQMGIAYANYFLAILKGFRDAQGNALAIILGSLVGVIAY
FT                   SLCYWLGGYEGTLAGLALVPALVVLPAGMMILHRKVMAFSSLKPLWDRAIASHLGKFTL
FT                   MALLTSITLPVAYIMMRNLLAARYSWEDVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLESRQEISREIVKALKFVLPAVAAASFSVWLLRDFVIWLLFSDKFTAMRDLFVWQLVG
FT                   DVLKVGAYVFGYLVIAKAALRFYILTEVSQFLLLTGFSHWLIPMNGALGAAQSYMATYI
FT                   VYFILCCSVFIIYRRRA"
     MSLAKASVWT AGSTLIKIGV GLLVIKLLAV SFGPTGVGQA GNFRQLITVL GVLSGAGIFN        60
     GVTKYVAEYH QQPERLSALL GTSSSIILGF STLLAVIFLL FSDAISVGLF GHNHYKIVVQ       120
     ALAFIQMGIA YANYFLAILK GFRDAQGNAL AIILGSLVGV IAYSLCYWLG GYEGTLAGLA       180
     LVPALVVLPA GMMILHRKVM AFSSLKPLWD RAIASHLGKF TLMALLTSIT LPVAYIMMRN       240
     LLAARYSWED VGIWQGVSSI SDAYLQFITA SFTVYLLPTL SRLESRQEIS REIVKALKFV       300
     LPAVAAASFS VWLLRDFVIW LLFSDKFTAM RDLFVWQLVG DVLKVGAYVF GYLVIAKAAL       360
     RFYILTEVSQ FLLLTGFSHW LIPMNGALGA AQSYMATYIV YFILCCSVFI IYRRRA           416
//

If you have problems or comments...

PBIL Back to PBIL home page